DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and clic1

DIOPT Version :10

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:77 Identity:26/77 - (33%)
Similarity:41/77 - (53%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVPALEIVREPGPPVLTESLLICEYL 94
            |||:||:.:||..|.:.::...:::..|||.|.:..|..:.|.|..    |..|.|::..|.|:|
Zfish    24 CPFSQRLFMVLWLKGVTFNVTTVDMKRKPEILKDLAPGAQPPFLLY----GTEVKTDTNKIEEFL 84

  Fly    95 DEQYPLRPLYPR 106
            :|.. ..|.|||
Zfish    85 EETL-CPPKYPR 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 20/64 (31%)
GST_C_Omega 109..229 CDD:198293
clic1NP_997847.1 O-ClC 6..241 CDD:129941 26/77 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.