DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and Gsto2

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:230 Identity:89/230 - (38%)
Similarity:130/230 - (56%) Gaps:17/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGK 69
            |.|.|||..|....:|::|:|||||||::.|..|||.||.|.:..|.|||.:||:|...|:|.|:
  Rat     7 RCLGKGSCPPGPVPEGVIRIYSMRFCPYSHRTRLVLKAKSIRHEIININLKNKPDWYYTKHPFGQ 71

  Fly    70 VPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERF-------RAVLGA 127
            ||.||   .....::.||::.|||||:.:|.|.|:|.||.::.:.|:|:|.|       :..|.|
  Rat    72 VPVLE---NSQCQLIYESVIACEYLDDVFPGRKLFPYDPYERARQKMLLELFCKVPQLSKECLVA 133

  Fly   128 FFKASDGGDLE-PFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNY 191
            .....|..||: .....|...|..|..:.|.||||:...::||::|||.|||::..|  .:..|:
  Rat   134 LRCGRDCTDLKVALRQELCNLEEILEYQNTTFFGGDSISMIDYLVWPWFERLDVYGL--ADCVNH 196

  Fly   192 DQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFL 226
            .    |.|.||:..||:||||.|.:::..:...||
  Rat   197 T----PMLRLWISSMKQDPAVCALHIDKNIFLGFL 227

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 41/89 (46%)
GstA 22..215 CDD:223698 79/200 (40%)
GST_C_Omega 109..229 CDD:198293 40/126 (32%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 41/89 (46%)