DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and Clic6

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:233 Identity:52/233 - (22%)
Similarity:94/233 - (40%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NG-RHLAKGSPMPDVPEDGILRLY--------SMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKP 58
            || |.....|...|:.::..:.|:        |:..|||:||:.::|..|.:.::...::|..||
  Rat   360 NGRRENGPASEEGDLGQEHDITLFVKAGSDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKP 424

  Fly    59 EWLLEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRA 123
            ..|....|....|.:....|    |.|:...|.|:|:|:. :.|.||:...:..:.........|
  Rat   425 ADLQNLAPGTNPPFMTFDGE----VKTDVNKIEEFLEEKL-VPPRYPKLGTQHPESNSAGNDVFA 484

  Fly   124 VLGAFFK--ASDGGDL-----------------EPFWSGLDIYERE---LARRGTEFFGGEQTGI 166
            ...||.|  ..|..|:                 .|....:|.|..|   :::|  :|..|::..:
  Rat   485 KFSAFIKNTKKDANDIYEKNLLRALKKLDSYLNSPLPDEIDAYSTEDVTVSQR--KFLDGDELTL 547

  Fly   167 LDYMIWPWCERLELLKLQRGEDYNYDQSRFP-QLT-LW 202
            .|..:.|   :|.::|:...:   |....|| ::| :|
  Rat   548 ADCNLLP---KLHIIKIVAKK---YRGFEFPSEMTGIW 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 25/100 (25%)
GstA 22..215 CDD:223698 47/213 (22%)
GST_C_Omega 109..229 CDD:198293 22/118 (19%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 47/213 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.