DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTT1

DIOPT Version :10

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_054181554.1 Gene:GSTT1 / 2952 HGNCID:4641 Length:289 Species:Homo sapiens


Alignment Length:60 Identity:21/60 - (35%)
Similarity:31/60 - (51%) Gaps:9/60 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPL-YPRDPLKKVQDKLLIERFRA 123
            ||..|||||    :.|...||||:.|..||..:|.:... ||:|    :|.:..::.:.|
Human    98 NPLKKVPAL----KDGDFTLTESVAILLYLTRKYKVPDYWYPQD----LQARARVDEYLA 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 14/29 (48%)
GST_C_Omega 109..229 CDD:198293 2/15 (13%)
GSTT1XP_054181554.1 GST_N_Theta 3..127 CDD:239348 15/32 (47%)
GST_C_Theta 140..265 CDD:198292 1/10 (10%)

Return to query results.
Submit another query.