DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GstE9

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:212 Identity:63/212 - (29%)
Similarity:82/212 - (38%) Gaps:38/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINL---TDKPEWLLEKNPQGKVPALEIVREPGP 81
            |.|.||.:...|..:...|.|||..:.|....:||   ..|.:....||||..||.||   :.| 
  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLE---DDG- 62

  Fly    82 PVLTESLLICEYLDEQYPLR-PLYPRDPLKKVQDKLLIERFRAVLGAFFKASDGGDLEPFW---- 141
            ..:.||..||.||..:|... .|||:|..|:.   |:.:|.....|..|:........|.:    
  Fly    63 KFIWESHAICAYLVRRYAKSDDLYPKDYFKRA---LVDQRLHFESGVLFQGCIRNIAIPLFYKNI 124

  Fly   142 -----SGLD-IYERELARRGTEFFGGEQT-------GILDYMIWPWCERLELLKLQRGEDYNYDQ 193
                 |.:| |||   |....|.|.|.|.       .|.||.:......|..|..       .|.
  Fly   125 TEVPRSQIDAIYE---AYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAA-------IDA 179

  Fly   194 SRFPQLTLWLERMKRDP 210
            .|:|:|..||:||...|
  Fly   180 KRYPKLNGWLDRMAAQP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 27/77 (35%)
GstA 22..215 CDD:223698 62/210 (30%)
GST_C_Omega 109..229 CDD:198293 30/119 (25%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 62/210 (30%)
GST_N_Delta_Epsilon 4..76 CDD:239343 26/75 (35%)
GST_C_Delta_Epsilon 92..209 CDD:198287 30/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.