DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and Clic6

DIOPT Version :10

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_766057.1 Gene:Clic6 / 209195 MGIID:2146607 Length:596 Species:Mus musculus


Alignment Length:239 Identity:51/239 - (21%)
Similarity:90/239 - (37%) Gaps:63/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NGRHLAKGSPMPDVPEDGILRLY--------SMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPE 59
            ||..|.:|.|    .::..:.|:        |:..|||:||:.::|..|.:.::...::|..||.
Mouse   348 NGPALEEGDP----GQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPA 408

  Fly    60 WLLEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAV 124
            .|....|....|.:....|    |.|:...|.|:|:|:. :.|.||:...:..:.........|.
Mouse   409 DLQNLAPGTNPPFMTFDGE----VKTDVNKIEEFLEEKL-VPPRYPKLGTQHPESNSAGNDVFAK 468

  Fly   125 LGAFFK--ASDGGDLEPFWSGLDIYERELAR---------------------------RGTEFFG 160
            ..||.|  ..|..         :|||:.|.|                           ...:|..
Mouse   469 FSAFIKNTKKDAN---------EIYEKNLLRALKKLDSYLNSPLPDEIDADSSEDVTVSQRKFLD 524

  Fly   161 GEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFP-QLT-LW 202
            |::..:.|..:.|   :|.::|:...:   |....|| ::| :|
Mouse   525 GDELTLADCNLLP---KLHIIKIVAKK---YRDFEFPSEMTGIW 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 25/99 (25%)
GST_C_Omega 109..229 CDD:198293 21/125 (17%)
Clic6NP_766057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..360 5/15 (33%)
2A1904 <51..338 CDD:273344
O-ClC 363..596 CDD:129941 46/220 (21%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 379..382 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.