DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and gst-44

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_507142.2 Gene:gst-44 / 184405 WormBaseID:WBGene00001792 Length:254 Species:Caenorhabditis elegans


Alignment Length:232 Identity:82/232 - (35%)
Similarity:112/232 - (48%) Gaps:19/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQ 67
            |.:.|..|...|..|.....|:|||||||.|||..:....|:||...|.|||..||:|...||.:
 Worm     8 NSKALKTGDLPPPSPSPNTFRIYSMRFCPAAQRALIYASVKKIPSEVININLQQKPDWYFTKNYK 72

  Fly    68 GKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVL----GAF 128
            |:||.||  ...|..::.||.:|.||||:.:|...:.|.||.:|||.|||:||....|    |..
 Worm    73 GQVPTLE--HAEGKKLVIESAVIPEYLDDIFPETKILPSDPYEKVQQKLLLERLSDQLTPAFGRV 135

  Fly   129 FKASDGGD--LEPFWSGLDIYER-ELARRGTEFFGGEQTGILDYMIWPWCER-------LELLKL 183
            |:|....:  .|.|.|.|..:|. |....|..:.|....|.:||:|:|..:|       ||:..|
 Worm   136 FRAIKNPEELKEKFESILKAFEEAESLLEGAFYSGTSSPGFVDYLIYPSFQRVYWLTFLLEIFPL 200

  Fly   184 QRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAE 220
            ...   |:....:|:|:.|.:.:...|.|.|.....|
 Worm   201 PSD---NFPGPGYPKLSQWFKAITAIPEVAAASQSTE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 39/91 (43%)
GstA 22..215 CDD:223698 75/206 (36%)
GST_C_Omega 109..229 CDD:198293 37/126 (29%)
gst-44NP_507142.2 Thioredoxin_like 8..98 CDD:294274 39/91 (43%)
GstA 29..229 CDD:223698 74/204 (36%)
GST_C_family 112..245 CDD:295467 37/126 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159276
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37971
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm4834
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.700

Return to query results.
Submit another query.