DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and gsto-1

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_498728.1 Gene:gsto-1 / 183000 WormBaseID:WBGene00016204 Length:250 Species:Caenorhabditis elegans


Alignment Length:253 Identity:81/253 - (32%)
Similarity:119/253 - (47%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVP 71
            :.||...|.:.: |..|:|:|||||:|:|..|.:.||.|....:.:|:|||.||...|:.|||.|
 Worm    11 IRKGDAEPPLSK-GSFRVYNMRFCPWAERAMLYVAAKGIEAEVVNLNVTDKLEWYWTKHYQGKAP 74

  Fly    72 ALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGA---FFKASD 133
            |:    |....|:.||..|.||||:.:|...:.|.||.:|||.|||.:|..||..|   .|....
 Worm    75 AV----EHNGKVVIESGFIPEYLDDAFPETRILPTDPYEKVQQKLLADRLTAVAHAVPLLFAVMR 135

  Fly   134 GGDLE-----PFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCER------------LELL 181
            ...|:     ..:..|...|..||   .:|:.|.|.|..||:.:|:.|:            |..:
 Worm   136 DRTLKDEKQRKVFEVLKQAENLLA---NDFYAGSQPGYPDYLSFPFFEKIWWSASLDGVVDLPTI 197

  Fly   182 KLQRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRP-NYNL 238
            :....|:|       |:||.|.::|.....|.:.....|..|.|:...:..:. ||:|
 Worm   198 EFPGEEEY-------PKLTKWFQKMISSDVVQSVTQSLEHGAAFMNAYATHQELNYDL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 36/87 (41%)
GstA 22..215 CDD:223698 71/212 (33%)
GST_C_Omega 109..229 CDD:198293 36/139 (26%)
gsto-1NP_498728.1 GST_N_Omega 7..94 CDD:239353 36/87 (41%)
GstA 27..229 CDD:223698 70/215 (33%)
GST_C_Omega 108..238 CDD:198293 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I5948
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37971
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm4834
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X130
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.