DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and gsto-3

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_741069.1 Gene:gsto-3 / 175196 WormBaseID:WBGene00019636 Length:309 Species:Caenorhabditis elegans


Alignment Length:222 Identity:81/222 - (36%)
Similarity:118/222 - (53%) Gaps:17/222 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQ 67
            |...|..||..|.: ..|..|||||||||:||||.:.|..|.||...:.:|....|.|.|.|:|.
 Worm    81 NSPTLHPGSIEPPL-TPGNYRLYSMRFCPYAQRVLIYLAKKNIPVEVVNVNPDRSPNWYLPKSPI 144

  Fly    68 GKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGAFFK-- 130
            |:||||||    ...|:.||.:|.|||||.:|...:.|||..:|...|:|:||...::.|.|:  
 Worm   145 GRVPALEI----NGKVVWESNVIVEYLDELFPTNTILPRDAYEKAHQKILVERLSPIMNALFEFY 205

  Fly   131 ASDGGDLEPFWSGLDIYERELARRGTE------FFGGEQTGILDYMIWPWCERLELLKLQRGEDY 189
            .|.........:.::::.   |.|.:|      |:||.|.|..||::||:.|||:||.:.....:
 Worm   206 GSSNNPQAQRQNDMNVHS---ALRNSENLLRDTFYGGRQPGYADYLMWPFLERLQLLTMSPNSQF 267

  Fly   190 NYDQS-RFPQLTLWLERMKRDPAVMAF 215
            .|... .:|::..::.||:..|.|:.|
 Worm   268 RYFPGLHYPKIGAYIARMQNQPEVLGF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 42/91 (46%)
GstA 22..215 CDD:223698 74/201 (37%)
GST_C_Omega 109..229 CDD:198293 32/116 (28%)
gsto-3NP_741069.1 GST_N_Omega 81..168 CDD:239353 42/91 (46%)
GST_C_Omega 182..308 CDD:198293 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I5948
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37971
Inparanoid 1 1.050 136 1.000 Inparanoid score I3130
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm4834
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.960

Return to query results.
Submit another query.