DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and Gsto1

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:255 Identity:94/255 - (36%)
Similarity:137/255 - (53%) Gaps:41/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQ 67
            :.|.|.|||..|....:|.:|:|||||||||||..:||.||.|.:..|.|||.:||||..||||.
Mouse     5 SSRSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININLKNKPEWFFEKNPL 69

  Fly    68 GKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAV---LGAFF 129
            |.||.||  ...| .::|||::.||||||.||.:.|:|.||.||.:.|:.:|.|..|   :.:|.
Mouse    70 GLVPVLE--NSQG-HLVTESVITCEYLDEAYPEKKLFPDDPYKKARQKMTLESFSKVPPLIASFV 131

  Fly   130 KASDGGD-----------LEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKL 183
            ::....|           .:....|:|.|:        .|.||:...::||:.|||.:|||.|:|
Mouse   132 RSKRKEDSPNLREALENEFKKLEEGMDNYK--------SFLGGDSPSMVDYLTWPWFQRLEALEL 188

  Fly   184 QRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYNLLVKDA 243
            :.      ..:..|:|.||:..|::||...:..::|:...|:|          ||.::|:
Mouse   189 KE------CLAHTPKLKLWMAAMQQDPVASSHKIDAKTYREYL----------NLYLQDS 232

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 48/91 (53%)
GstA 22..215 CDD:223698 81/206 (39%)
GST_C_Omega 109..229 CDD:198293 34/133 (26%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 48/91 (53%)
GstA 26..224 CDD:223698 81/214 (38%)