DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and C02D5.4

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001254962.1 Gene:C02D5.4 / 13190517 WormBaseID:WBGene00043097 Length:254 Species:Caenorhabditis elegans


Alignment Length:254 Identity:81/254 - (31%)
Similarity:123/254 - (48%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQ 67
            |.:.:..|.|.|..|..|.:|:|:|||||:|||..:....|.||...|.::|.:||:|...|:.:
 Worm     8 NSKIVKNGDPAPAPPAAGTIRIYNMRFCPWAQRALIYASVKNIPSDVINVHLQEKPDWYFSKHYK 72

  Fly    68 GKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRA-VLGAFF-- 129
            |:||.||  .:.|...:.||.:|.||||:.||...:.|.||.:|||.|||::|... |..||:  
 Worm    73 GQVPTLE--HDEGKKHVIESAVIPEYLDDIYPETRILPTDPYEKVQQKLLLDRISGQVSPAFYGV 135

  Fly   130 -KASDGGDL--EPFWSGLDIYER-ELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRG---- 186
             :|....||  |.|......|:. |....|..:.|..:.|.:||:::|        .:||.    
 Worm   136 VQAVKNPDLREEKFADIKKAYDNAEQLLTGDFYSGTSKPGFVDYLLYP--------NIQRAYWAA 192

  Fly   187 --------EDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYN 237
                    |..::....:|:|:.|.:.::..|.|.|.....|....|.:....|.|||:
 Worm   193 HIVPDFPLEAESFPGPNYPRLSKWYKALESIPEVAAASQPTENGVGFFKDYLGGSPNYD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 36/91 (40%)
GstA 22..215 CDD:223698 68/211 (32%)
GST_C_Omega 109..229 CDD:198293 34/138 (25%)
C02D5.4NP_001254962.1 Thioredoxin_like 8..98 CDD:294274 36/91 (40%)
GstA 29..229 CDD:223698 67/209 (32%)
GST_C_family 112..243 CDD:295467 34/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159275
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37971
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm4834
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.750

Return to query results.
Submit another query.