DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTO2

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:247 Identity:92/247 - (37%)
Similarity:129/247 - (52%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGK 69
            |.|.|||..|....:|::|:|||||||::.|..|||.||.|.:..:.|||.:||||...|:|.|.
Human     7 RTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGH 71

  Fly    70 VPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERF-------RAVLGA 127
            :|.||..:   ..::.||::.|||||:.||.|.|:|.||.::.:.|:|:|.|       :..|.|
Human    72 IPVLETSQ---CQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVA 133

  Fly   128 F--------FKASDGGDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQ 184
            .        .||:    |...:|.|   |..|..:.|.||||....::||::|||.|||::..: 
Human   134 LRCGRECTNLKAA----LRQEFSNL---EEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGI- 190

  Fly   185 RGEDYNYD-QSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPN 235
                  .| .|..|.|.||:..||.||.|.|..|:..:...||.......||
Human   191 ------LDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPN 236

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 40/89 (45%)
GstA 22..215 CDD:223698 79/208 (38%)
GST_C_Omega 109..229 CDD:198293 41/135 (30%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 40/89 (45%)