DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and CAM1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:44/178 - (24%)
Similarity:67/178 - (37%) Gaps:43/178 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PLLKVPALQLVAEKGEPSLIESLIIAEYL-----DDKYPENPLLPKDPLKRAQDKILLERFSSIT 125
            ||.||||  .|..||. .|.|::.|..||     |||. :..||..|....||.:|:  |:.|:.
Yeast    45 PLKKVPA--FVGPKGY-KLTEAMAINYYLVKLSQDDKM-KTQLLGADDDLNAQAQII--RWQSLA 103

  Fly   126 SAFINILVQGT-----------------GLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDY--- 170
            ::.:.|.:..|                 .::.....:||||..|  :...|.........|.   
Yeast   104 NSDLCIQIANTIVPLKGGAPYNKKSVDSAMDAVDKIVDIFENRL--KNYTYLATENISLADLVAA 166

  Fly   171 -MIWPWFERLSVIELKLQKEYNFNESRFPKITKWIALLKADSVVQSFY 217
             :...:||.|...|.:.|         .|.|.:|...::|...::..|
Yeast   167 SIFTRYFESLFGTEWRAQ---------HPAIVRWFNTVRASPFLKDEY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 14/33 (42%)
GstA 22..209 CDD:223698 42/168 (25%)
GST_C_Omega 109..230 CDD:198293 24/130 (18%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 14/30 (47%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 24/127 (19%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.