DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and YGR201C

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:40/166 - (24%)
Similarity:62/166 - (37%) Gaps:45/166 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PLLKVPALQLVAEKGEPSLIESLIIAEYL----DDKYPENPLL-PKDPLKRAQDKILLERFSSIT 125
            ||.|.|.  .|....|.:|.|::.|..||    .||.....|| |:...|...|.:..|..|:  
Yeast    49 PLRKYPT--FVGPHDEWTLTEAMAIDYYLIHLSSDKEAVRQLLGPEGDFKTRADILRWESLSN-- 109

  Fly   126 SAFIN----ILVQGTGLEDY------------WTALDIFEEELTKRGTPYFGGNKPGFVDYMIWP 174
            |.|:|    :.....|::.|            .|.:.::|:.|.|:             .|::..
Yeast   110 SDFLNEVCEVFFPLIGVKPYNATEFKAARENVDTIVSLYEKRLKKQ-------------QYLVCD 161

  Fly   175 WFERL----SVIELKLQKEYNFNE---SRFPKITKW 203
            ..|.|    |.....|.....|:|   |:.|::|:|
Yeast   162 DHETLADLISAAAFSLGFISFFDETWRSKHPEVTRW 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 11/32 (34%)
GstA 22..209 CDD:223698 40/166 (24%)
GST_C_Omega 109..230 CDD:198293 24/118 (20%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 11/30 (37%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 23/115 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.