DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GTT2

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:52/229 - (22%)
Similarity:85/229 - (37%) Gaps:57/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LYSMRFCPYAQRAHLVLNAKNV--PYHSVYINL----TEKPEWLVE----VSPLLKVPALQLVAE 78
            :|.....||..|..:.|..||:  ....|.|||    .:|||:|.:    ..|:|::....|:| 
Yeast    21 IYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTLIA- 84

  Fly    79 KGEPSLIESLIIAEYLDDKYPENPLLPKDPL---------KRAQDKILLERFSSITSAFINILVQ 134
                   |...|.||:|.......|..|.||         |||:.::|     ...|.:.:....
Yeast    85 -------ECTAITEYIDALDGTPTLTGKTPLEKGVIHMMNKRAELELL-----DPVSVYFHHATP 137

  Fly   135 GTG--LEDY----W---------TALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIEL 184
            |.|  :|.|    |         ..:..|:..|.:|  ||..|:.....|..:.......::::|
Yeast   138 GLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRER--PYVAGDSFSMADITVIAGLIFAAIVKL 200

  Fly   185 KLQKE-------YNFNESRFPKITKWIALLKADS 211
            ::.:|       |...:.| |.:.|.:.:....|
Yeast   201 QVPEECEALRAWYKRMQQR-PSVKKLLEIRSKSS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 23/80 (29%)
GstA 22..209 CDD:223698 51/225 (23%)
GST_C_Omega 109..230 CDD:198293 25/134 (19%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 23/80 (29%)
GST_C_GTT2_like 106..222 CDD:198291 24/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.