DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU19

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_565178.1 Gene:GSTU19 / 844174 AraportID:AT1G78380 Length:219 Species:Arabidopsis thaliana


Alignment Length:215 Identity:64/215 - (29%)
Similarity:101/215 - (46%) Gaps:33/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FCP--YAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLIESLII 90
            |.|  :..|..:.|..|.|.:.....:|..|...|::::|: .|:|.|   ...|:| :.||:|.
plant    10 FWPSMFGMRTRIALREKGVEFEYREEDLRNKSPLLLQMNPIHKKIPVL---IHNGKP-VNESIIQ 70

  Fly    91 AEYLDDKYP-ENPLLPKDPLKRAQ--------DKILLERFSSITSAFINILVQGTGLEDYWTALD 146
            .:|:|:.:. :||:||.||..|||        ||.|.:....:.:.  ....|..|.:|:...|.
plant    71 VQYIDEVWSHKNPILPSDPYLRAQARFWADFIDKKLYDAQRKVWAT--KGEEQEAGKKDFIEILK 133

  Fly   147 IFEEELTKRGTPYFGGNKPGFVDYMI---WPWFERLSVIELKLQKEYNFN-ESRFPKITKWI-AL 206
            ..|.||..:  |||.|:..|:||..:   :.||.       ..:|..||: ||..||:..|: ..
plant   134 TLESELGDK--PYFSGDDFGYVDIALIGFYTWFP-------AYEKFANFSIESEVPKLIAWVKKC 189

  Fly   207 LKADSVVQSFYATPEQHNEF 226
            |:.:||.:|. ..||:..||
plant   190 LQRESVAKSL-PDPEKVTEF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 19/68 (28%)
GstA 22..209 CDD:223698 57/196 (29%)
GST_C_Omega 109..230 CDD:198293 38/131 (29%)
GSTU19NP_565178.1 GST_N_Tau 5..78 CDD:239356 20/71 (28%)
GST_C_Tau 89..212 CDD:198294 39/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.