DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU20

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_177958.1 Gene:GSTU20 / 844173 AraportID:AT1G78370 Length:217 Species:Arabidopsis thaliana


Alignment Length:219 Identity:63/219 - (28%)
Similarity:98/219 - (44%) Gaps:44/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLIESLIIAEYLD 95
            :..||.:.|..|.|.:.....:.:.|...|::.:|: .|:|.|   ...|:| :.|||.:.:|:|
plant    15 FGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVL---VHNGKP-VCESLNVVQYVD 75

  Fly    96 DKYPE-NPLLPKDPLKRAQDKILLERF------SSITSAFINIL-----VQGTGLEDYWTALDIF 148
            :.:|| ||..|.||..|||     .||      ...|.|...:.     .|..|.:::..|:.|.
plant    76 EAWPEKNPFFPSDPYGRAQ-----ARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKIL 135

  Fly   149 EEELTKRGTPYFGGNKPGFVDYMI---WPWFERLSVIELKLQKEYNFN-ESRFPKITKWI-ALLK 208
            |.||..:  |||||:..|:||..:   ..||:       ..:|..||: ||..||:..|. ..::
plant   136 ESELGDK--PYFGGDSFGYVDISLITFSSWFQ-------AYEKFGNFSIESESPKLIAWAKRCME 191

  Fly   209 ADSVVQSF--------YATPEQHN 224
            .:||.:|.        ||...:.|
plant   192 KESVSKSLPDSEKIVAYAAEYRKN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 17/63 (27%)
GstA 22..209 CDD:223698 57/194 (29%)
GST_C_Omega 109..230 CDD:198293 38/140 (27%)
GSTU20NP_177958.1 GST_N_Tau 6..78 CDD:239356 18/66 (27%)
GST_C_Tau 89..209 CDD:198294 36/133 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.