Sequence 1: | NP_648234.1 | Gene: | GstO3 / 38972 | FlyBaseID: | FBgn0035904 | Length: | 241 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_177598.1 | Gene: | GSTU10 / 843799 | AraportID: | AT1G74590 | Length: | 232 | Species: | Arabidopsis thaliana |
Alignment Length: | 203 | Identity: | 48/203 - (23%) |
---|---|---|---|
Similarity: | 80/203 - (39%) | Gaps: | 59/203 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 YAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLIESLIIAEYLD 95
Fly 96 DKYPENP-LLPKDPLKRAQDKILLERFSSITSAFINIL---------VQGTGLEDYWTALDIFEE 150
Fly 151 ELTKR---------------------------------GTPYFGG-NKPGFVDYMIWPWFERLSV 181
Fly 182 IELKLQKE 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstO3 | NP_648234.1 | Thioredoxin_like | 3..95 | CDD:294274 | 22/63 (35%) |
GstA | 22..209 | CDD:223698 | 48/203 (24%) | ||
GST_C_Omega | 109..230 | CDD:198293 | 21/124 (17%) | ||
GSTU10 | NP_177598.1 | GST_N_Tau | 8..81 | CDD:239356 | 23/66 (35%) |
GST_C_Tau | 92..221 | CDD:198294 | 22/125 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0406 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 83 | 1.000 | Inparanoid score | I2350 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1225872at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X130 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.870 |