DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU10

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_177598.1 Gene:GSTU10 / 843799 AraportID:AT1G74590 Length:232 Species:Arabidopsis thaliana


Alignment Length:203 Identity:48/203 - (23%)
Similarity:80/203 - (39%) Gaps:59/203 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLIESLIIAEYLD 95
            |::|..:.|..|.|.|..:..:|..|.|.|::::|: .|:|.|   ...|:| :.|||:|.||:|
plant    18 YSKRVEIALKLKGVLYEYLEEDLQNKSESLIQLNPVHKKIPVL---VHDGKP-VAESLVILEYID 78

  Fly    96 DKYPENP-LLPKDPLKRAQDKILLERFSSITSAFINIL---------VQGTGLEDYWTALDIFEE 150
            :.:..:| ..|:||.:|||.:..:   |.|......::         .|...:|:......:.:|
plant    79 ETWTNSPRFFPEDPYERAQVRFWV---SYINQQVFEVMGQVMSQEGEAQAKSVEEARKRFKVLDE 140

  Fly   151 ELTKR---------------------------------GTPYFGG-NKPGFVDYMIWPWFERLSV 181
            .|.|.                                 |....|. |.|     .::.|.|||. 
plant   141 GLKKHFPNKNIRRNDDVGLLEITIIATLGGYKAHREAIGVDIIGPVNTP-----TLYNWIERLQ- 199

  Fly   182 IELKLQKE 189
             :|.:.||
plant   200 -DLSVIKE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 22/63 (35%)
GstA 22..209 CDD:223698 48/203 (24%)
GST_C_Omega 109..230 CDD:198293 21/124 (17%)
GSTU10NP_177598.1 GST_N_Tau 8..81 CDD:239356 23/66 (35%)
GST_C_Tau 92..221 CDD:198294 22/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.