DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU12

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_177150.2 Gene:GSTU12 / 843328 AraportID:AT1G69920 Length:254 Species:Arabidopsis thaliana


Alignment Length:244 Identity:62/244 - (25%)
Similarity:109/244 - (44%) Gaps:41/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KGSPKPVLPDDG---VLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTE----KPEWLVEVSP 66
            |...|..:..:|   .::|......|:|.||.:.|:.|:|.:.  |:..|:    |.:.|::.:|
plant    19 KKRKKTTMAQNGSNTTVKLIGTWASPFAIRAQVALHLKSVEHE--YVEETDVLKGKSDLLIKSNP 81

  Fly    67 L-LKVPALQLVAEKGEPSLIESLIIAEYLDDKYPEN-PLLPKDPLKRA--------QDKILLERF 121
            : .|||.|    ..|:.|:.|||.|.:|:|:.:|.: .:||..|.:||        .|..|.|..
plant    82 IHKKVPVL----IHGDVSICESLNIVQYVDESWPSDLSILPTLPSERAFARFWAHFVDGKLFESI 142

  Fly   122 SSITSA---FINILVQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIE 183
            .::..|   ...:.:.|..:|:.....:.|::  :.:|..:|||...||||..:......:||||
plant   143 DAVAGAKDDAARMTLAGNLMENLAALEEAFQK--SSKGGDFFGGGNIGFVDITVGAIVGPISVIE 205

  Fly   184 LKLQKEYNFNESRF------PKITKWIALLKADSVVQSFYATPEQHNEF 226
            .       |:..:|      |.:.:|....:|...|:.:..|..:..||
plant   206 A-------FSGVKFLRPDTTPGLIQWAEKFRAHEAVKPYMPTVAEFIEF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 27/93 (29%)
GstA 22..209 CDD:223698 54/209 (26%)
GST_C_Omega 109..230 CDD:198293 30/135 (22%)
GSTU12NP_177150.2 GST_N_Tau 35..110 CDD:239356 25/80 (31%)
GstA 36..243 CDD:223698 57/221 (26%)
GST_C_Tau 121..250 CDD:198294 31/136 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.