DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU15

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_176176.1 Gene:GSTU15 / 842257 AraportID:AT1G59670 Length:233 Species:Arabidopsis thaliana


Alignment Length:224 Identity:56/224 - (25%)
Similarity:94/224 - (41%) Gaps:52/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINL-TEKPEWLVEVSPLL-KVPALQLVAEKGEPSL 84
            ::|....:.|...||.:.|..|:|.|..|..:| ..|.|.|::.:|:. |||.|   ....:|..
plant     7 VKLLGTWYSPVVIRAKIALRLKSVDYDYVEEDLFGSKSELLLKSNPIFKKVPVL---IHNTKPVC 68

  Fly    85 IESLIIAEYLDDKYPE--NPLLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYW----- 142
            : ||.|.||:|:.:..  :.:||..|..||     |.||.|:   |:         :|.|     
plant    69 V-SLNIVEYIDETWNSSGSSILPSHPYDRA-----LARFWSV---FV---------DDKWLPTLM 115

  Fly   143 ------------TALDIFEEELTK---------RGTPYFGGNKPGFVDYMIWPWFERLSVIELKL 186
                        ..::..||.|.:         :|..:|||...||:|..:..:...|...| ||
plant   116 AAVVAKSEEAKAKGMEEVEEGLLQLEAAFIALSKGKSFFGGETIGFIDICLGSFLVLLKARE-KL 179

  Fly   187 QKEYNFNESRFPKITKWIALLKADSVVQS 215
            :.|...:|.:.|.:.:|.....::.:|::
plant   180 KNEKILDELKTPSLYRWANQFLSNEMVKN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 24/74 (32%)
GstA 22..209 CDD:223698 55/216 (25%)
GST_C_Omega 109..230 CDD:198293 28/133 (21%)
GSTU15NP_176176.1 GST_N_Tau 7..81 CDD:239356 25/77 (32%)
GST_C_Tau 93..223 CDD:198294 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.