DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU28

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_175772.1 Gene:GSTU28 / 841805 AraportID:AT1G53680 Length:224 Species:Arabidopsis thaliana


Alignment Length:193 Identity:55/193 - (28%)
Similarity:86/193 - (44%) Gaps:39/193 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLIESLIIAEYL 94
            |||.|..:.|..|.|.:.....:|..|.|.|::.:|: .|||.|   .....| :.||||..:|:
plant    17 PYAMRTKVALREKGVEFEVQEEDLWNKSELLLKSNPVHKKVPVL---IHNNTP-ISESLIQVQYI 77

  Fly    95 DDKYPE-NPLLPKDPLKRAQDKILLERFSSITSAFINILVQG--------------TGLEDYWTA 144
            |:.:.: ...||.||..||..:...: ::..|.:|     :|              .|.:::..:
plant    78 DETWTDAASFLPSDPQSRATARFWAD-YADKTISF-----EGGRKIWGNKKGEEQEKGKKEFLES 136

  Fly   145 LDIFEEELTKRGTPYFGGNKPGFVDYMIWP---WFERLSVIELKLQKEYNFN-ESRFPKITKW 203
            |.:.|.||..:.  ||||...|:||..:.|   ||       ..|:|..:|: |:..|||..|
plant   137 LKVLEAELGDKS--YFGGETFGYVDITLVPFYSWF-------YALEKCGDFSVEAECPKIVAW 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 22/64 (34%)
GstA 22..209 CDD:223698 55/193 (28%)
GST_C_Omega 109..230 CDD:198293 28/113 (25%)
GSTU28NP_175772.1 GST_N_Tau 8..81 CDD:239356 23/67 (34%)
GST_C_Tau 92..217 CDD:198294 29/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.