DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU13

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_174033.1 Gene:GSTU13 / 839602 AraportID:AT1G27130 Length:227 Species:Arabidopsis thaliana


Alignment Length:213 Identity:61/213 - (28%)
Similarity:96/213 - (45%) Gaps:34/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PYAQRAHLVLNAKNVPYHSVYIN----LTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLIESLII 90
            ||:.||.:.|:.|:|.|.  |::    |.||.|.|::.:|: .|||.|.    .|:.|:.|||.:
plant    16 PYSLRARVALHLKSVKYE--YLDEPDVLKEKSELLLKSNPIHKKVPVLL----HGDLSISESLNV 74

  Fly    91 AEYLDDKYPENP-LLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTA-------LDI 147
            .:|:|:.:|..| :||.|...||..:...:.......|.::.:|.....|....|       |.|
plant    75 VQYVDEAWPSVPSILPSDAYDRASARFWAQYIDDKCFAAVDAVVGAKDDEGKMAAVGKLMECLAI 139

  Fly   148 FEEELTK--RGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRF------PKITKWI 204
            .||...|  :|..:|||...|::|.........:||||.       |:..:|      |.:.||.
plant   140 LEETFQKSSKGLGFFGGETIGYLDIACSALLGPISVIEA-------FSGVKFLRQETTPGLIKWA 197

  Fly   205 ALLKADSVVQSFYATPEQ 222
            ...:|...|:.:..|.|:
plant   198 ERFRAHEAVKPYMPTVEE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 25/68 (37%)
GstA 22..209 CDD:223698 57/198 (29%)
GST_C_Omega 109..230 CDD:198293 30/129 (23%)
GSTU13NP_174033.1 GST_N_Tau 7..82 CDD:239356 26/71 (37%)
GstA 8..219 CDD:223698 61/213 (29%)
GST_C_Tau 93..222 CDD:198294 30/130 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.