DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and AT1G19550

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_173386.1 Gene:AT1G19550 / 838542 AraportID:AT1G19550 Length:153 Species:Arabidopsis thaliana


Alignment Length:190 Identity:46/190 - (24%)
Similarity:72/190 - (37%) Gaps:72/190 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKYPENP 102
            ||:...:.|.|.::        |  ::||..|||.|::    .:..:.:|......|::|||:.|
plant     2 LVVQICSSPSHEMF--------W--DISPQGKVPVLKI----DDKWVTDSDATVGILEEKYPDPP 52

  Fly   103 LLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPGF 167
            |  |.|.:          |:|:.|   ||             .:..|..|.....|:..|     
plant    53 L--KTPAE----------FASVGS---NI-------------FEALENHLKSHDGPFIAG----- 84

  Fly   168 VDYMIWPWFERLSVIELKL-QKEYNFNESRFPKITKWIAL--LKADSVVQSFYATPEQHN 224
                     ||:|.::|.| .|.|:..          :||  .|:.||.:||   |..||
plant    85 ---------ERVSAVDLSLAPKLYHLQ----------VALGHFKSWSVPESF---PHVHN 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 12/56 (21%)
GstA 22..209 CDD:223698 38/173 (22%)
GST_C_Omega 109..230 CDD:198293 26/119 (22%)
AT1G19550NP_173386.1 PLN02378 <9..153 CDD:166019 44/183 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.