DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU25

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_173161.1 Gene:GSTU25 / 838289 AraportID:AT1G17180 Length:221 Species:Arabidopsis thaliana


Alignment Length:215 Identity:63/215 - (29%)
Similarity:102/215 - (47%) Gaps:32/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LPDDGVLRLYSMRFCP--YAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVA 77
            :.|:.:|    :.|.|  :..|..:.|..|||.:.....:|..|...|:|::|: .|:|.|   .
plant     1 MADEVIL----LDFWPSMFGMRTRIALEEKNVKFDYREQDLWNKSPILLEMNPVHKKIPVL---I 58

  Fly    78 EKGEPSLIESLIIAEYLDDKYP-ENPLLPKDPLKRAQDKILLERFSSITSAFINIL--VQG---- 135
            ..|.| :.||||..||:|:.:| :.||||.||.:|||.|...:.......|...::  .:|    
plant    59 HNGNP-VCESLIQIEYIDEVWPSKTPLLPSDPYQRAQAKFWGDFIDKKVYASARLIWGAKGEEHE 122

  Fly   136 TGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMI---WPWFERLSVIELKLQKEYNFN-ESR 196
            .|.:::...|...|.||..:  .||||...|:||..:   :.|||       ..:|..:|: |:.
plant   123 AGKKEFIEILKTLESELGDK--TYFGGETFGYVDIALIGFYSWFE-------AYEKFGSFSIEAE 178

  Fly   197 FPKITKW-IALLKADSVVQS 215
            .||:..| ...::.:||.:|
plant   179 CPKLIAWGKRCVERESVAKS 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 25/81 (31%)
GstA 22..209 CDD:223698 59/201 (29%)
GST_C_Omega 109..230 CDD:198293 30/118 (25%)
GSTU25NP_173161.1 GST_N_Tau 5..78 CDD:239356 25/80 (31%)
GST_C_Tau 89..209 CDD:198294 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.