DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and ERD9

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_172508.4 Gene:ERD9 / 837576 AraportID:AT1G10370 Length:227 Species:Arabidopsis thaliana


Alignment Length:201 Identity:59/201 - (29%)
Similarity:94/201 - (46%) Gaps:49/201 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLIESLIIAEYL 94
            |:..|..:.||.|:|||..:......|.|.|::.:|: .|:|.| |.|:|   .:.||.||.||:
plant    15 PFVMRPRIALNLKSVPYEFLQETFGSKSELLLKSNPVHKKIPVL-LHADK---PVSESNIIVEYI 75

  Fly    95 DDKYPEN--PLLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTALDIF-----EEE- 151
            ||.:..:  .:||.||..||     :.||   .:|:|:        |.::.||..|     ||| 
plant    76 DDTWSSSGPSILPSDPYDRA-----MARF---WAAYID--------EKWFVALRGFLKAGGEEEK 124

  Fly   152 -------------LTK------RGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRF 197
                         |.|      :|.|:|.|:..|::|..:..:...|.|.||.:..:. .:|::.
plant   125 KAVIAQLEEGNAFLEKAFIDCSKGKPFFNGDNIGYLDIALGCFLAWLRVTELAVSYKI-LDEAKT 188

  Fly   198 PKITKW 203
            |.::||
plant   189 PSLSKW 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 24/64 (38%)
GstA 22..209 CDD:223698 59/201 (29%)
GST_C_Omega 109..230 CDD:198293 29/120 (24%)
ERD9NP_172508.4 GST_N_Tau 6..79 CDD:239356 26/67 (39%)
GST_C_Tau 91..221 CDD:198294 30/121 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.