DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU18

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_172507.1 Gene:GSTU18 / 837575 AraportID:AT1G10360 Length:227 Species:Arabidopsis thaliana


Alignment Length:214 Identity:53/214 - (24%)
Similarity:95/214 - (44%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDD 96
            |..||.:.|:.|::.|..:......|.|.|::.:|:.|...:.:.|:|   .:.||.||..|:|:
plant    16 YVMRARIALHLKSISYEFLQETYGSKSELLLKSNPVHKKMPVLIHADK---PVCESNIIVHYIDE 77

  Fly    97 KYPEN--PLLPKDPLKRAQDKILLERFSSI---TSAFINI--LVQGTGLEDYWTALDIFEEELTK 154
            .:..:  .:||..|..||     :.||.:.   ...||::  ::...|.|:...|:...||. ||
plant    78 AWNSSGPSILPSHPYDRA-----IARFWAAYIDDQWFISVRSILTAQGDEEKKAAIAQVEER-TK 136

  Fly   155 ----------RGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKITKWIALLKA 209
                      :|.|:|.|:..|::|..:..:.....|:||....:: .:|::.|.:.||......
plant   137 LLEKAFNDCSQGKPFFNGDHIGYLDIALGSFLGWWRVVELDANHKF-LDETKTPSLVKWAERFCD 200

  Fly   210 DSVVQSFYATPEQHNEFWR 228
            |..|:.......:..||.|
plant   201 DPAVKPIMPEITKLAEFAR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 18/62 (29%)
GstA 22..209 CDD:223698 48/193 (25%)
GST_C_Omega 109..230 CDD:198293 31/135 (23%)
GSTU18NP_172507.1 GST_N_Tau 6..79 CDD:239356 19/65 (29%)
GST_C_Tau 91..221 CDD:198294 32/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.