DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU9

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_851249.1 Gene:GSTU9 / 836368 AraportID:AT5G62480 Length:240 Species:Arabidopsis thaliana


Alignment Length:221 Identity:58/221 - (26%)
Similarity:95/221 - (42%) Gaps:37/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLIESLIIAEYL 94
            ||::|..|.|..|::||..|..:|..|.:.|:..:|: .|:|.|   ...|:| :.|||.|.||:
plant    18 PYSKRIELALRLKSIPYQFVQEDLQNKSQTLLRYNPVHKKIPVL---VHNGKP-ISESLFIIEYI 78

  Fly    95 DDKYPENP-LLPKDPLKRAQ-----DKILLERFSSITSAFINILVQGTG------LEDYWTALDI 147
            |:.:...| :||:||.:|::     :.|.|..:..:..     :|:..|      |.:....|.:
plant    79 DETWSNGPHILPEDPYRRSKVRFWANYIQLHLYDLVIK-----VVKSEGEEQKKALTEVKEKLSV 138

  Fly   148 FEEELTKR------GTPYFGGNKPGFVDY----MIWPWFERLSVIELKLQKEYNFNESRFPKITK 202
            .|:|..|.      |.|.........||.    ::.|:.....|:.||:     .:....|.:..
plant   139 IEKEGLKEIFSDTDGEPTVTNETMSLVDIVMCTLLSPYKAHEEVLGLKI-----IDPEIVPGVYG 198

  Fly   203 WIALLKADSVVQSFYATPEQHNEFWR 228
            ||..:...|||:......||..|..|
plant   199 WINAINETSVVKDLSPPYEQILEILR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 24/64 (38%)
GstA 22..209 CDD:223698 51/200 (26%)
GST_C_Omega 109..230 CDD:198293 28/141 (20%)
GSTU9NP_851249.1 GST_N_Tau 9..82 CDD:239356 25/67 (37%)
GstA 10..183 CDD:223698 45/173 (26%)
GST_C_Tau 93..226 CDD:198294 29/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.