DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTL1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001318461.1 Gene:GSTL1 / 831800 AraportID:AT5G02780 Length:237 Species:Arabidopsis thaliana


Alignment Length:216 Identity:67/216 - (31%)
Similarity:95/216 - (43%) Gaps:28/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DGVLRLYSMRFCPYAQRAHLVLNAKNV--PYHSVYINLTEKPEWLVE-VSPLLKVPALQLVAEKG 80
            ||..|||....||:|||..:..|.|.:  ....|.|:|..:|.||.| |:|..|||||    |..
plant    28 DGTTRLYISYTCPFAQRVWITRNLKGLQDEIKLVPIDLPNRPAWLKEKVNPANKVPAL----EHN 88

  Fly    81 EPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINIL---VQGTGLEDYW 142
            .....|||.:.:|:|..:....|.|:|..||...:.||:   .:...|:..:   .:|..:::..
plant    89 GKITGESLDLIKYVDSNFDGPSLYPEDSAKREFGEELLK---YVDETFVKTVFGSFKGDPVKETA 150

  Fly   143 TALDIFEEELTK-RGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKITKWIAL 206
            :|.|..|..|.| ...|:|.| :...||....|:.||..|...::.| |.....| |.:..||..
plant   151 SAFDHVENALKKFDDGPFFLG-ELSLVDIAYIPFIERFQVFLDEVFK-YEIIIGR-PNLAAWIEQ 212

  Fly   207 L---------KADS--VVQSF 216
            :         |.||  ||..|
plant   213 MNKMVAYTQTKTDSEYVVNYF 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 31/78 (40%)
GstA 22..209 CDD:223698 59/202 (29%)
GST_C_Omega 109..230 CDD:198293 32/123 (26%)
GSTL1NP_001318461.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.