DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTL3

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_195899.1 Gene:GSTL3 / 831798 AraportID:AT5G02790 Length:235 Species:Arabidopsis thaliana


Alignment Length:205 Identity:64/205 - (31%)
Similarity:95/205 - (46%) Gaps:19/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DGVLRLYSMRFCPYAQRAHLVLNAKNV--PYHSVYINLTEKPEWLVE-VSPLLKVPALQLVAEKG 80
            ||..|||:...||:|||..:..|.|.:  ....|.::|..:|.|..| |.|..|||||    |..
plant    26 DGTTRLYTSYVCPFAQRVWITRNFKGLQEKIKLVPLDLGNRPAWYKEKVYPENKVPAL----EHN 86

  Fly    81 EPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFIN---ILVQGTGLEDYW 142
            ...:.|||.:.:|||:.:....|.|:|..||.....||:    .|..|:.   :.::|...::..
plant    87 GKIIGESLDLIKYLDNTFEGPSLYPEDHAKREFGDELLK----YTDTFVKTMYVSLKGDPSKETA 147

  Fly   143 TALDIFEEELTK-RGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKITKWI-A 205
            ..||..|..|.| ...|:|.| :...||....|:.||...:..:|.| .:....| ||::.|| .
plant   148 PVLDYLENALYKFDDGPFFLG-QLSLVDIAYIPFIERFQTVLNELFK-CDITAER-PKLSAWIEE 209

  Fly   206 LLKADSVVQS 215
            :.|:|...|:
plant   210 INKSDGYAQT 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 29/78 (37%)
GstA 22..209 CDD:223698 59/194 (30%)
GST_C_Omega 109..230 CDD:198293 30/112 (27%)
GSTL3NP_195899.1 GstA 31..210 CDD:223698 58/189 (31%)
GST_N_3 31..108 CDD:290153 28/80 (35%)
GST_C_Lambda 113..231 CDD:198312 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.