DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and DHAR3

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_568336.1 Gene:DHAR3 / 831532 AraportID:AT5G16710 Length:258 Species:Arabidopsis thaliana


Alignment Length:218 Identity:62/218 - (28%)
Similarity:98/218 - (44%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYL 94
            ||:.|:..|.:..|||||....::|:.||||.:::||..|||.::. .||..|   :|.:|.:.|
plant    66 CPFCQKVLLTMEEKNVPYDMKMVDLSNKPEWFLKISPEGKVPVVKF-DEKWVP---DSDVITQAL 126

  Fly    95 DDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINILV---QGTGLEDYWTALDIFEEELT--- 153
            ::||||.||  ..|.::|...      |.|.|.|:..|.   .|.|.|      .:..:|||   
plant   127 EEKYPEPPL--ATPPEKASVG------SKIFSTFVGFLKSKDSGDGTE------QVLLDELTTFN 177

  Fly   154 ---KRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKITKWIALLKADSVV-- 213
               |...|:..|.|....|..:.|....:. |.|...|.::..:| .|.:..::     ::|.  
plant   178 DYIKDNGPFINGEKISAADLSLAPKLYHMK-IALGHYKNWSVPDS-LPFVKSYM-----ENVFSR 235

  Fly   214 QSFYATPEQHNEF---WRTRKAG 233
            :||..|..:..:.   ||.:..|
plant   236 ESFTNTRAETEDVIAGWRPKVMG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 24/64 (38%)
GstA 22..209 CDD:223698 55/187 (29%)
GST_C_Omega 109..230 CDD:198293 29/134 (22%)
DHAR3NP_568336.1 PLN02817 3..258 CDD:166458 61/216 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.