DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTL2

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_191064.1 Gene:GSTL2 / 824670 AraportID:AT3G55040 Length:292 Species:Arabidopsis thaliana


Alignment Length:233 Identity:69/233 - (29%)
Similarity:101/233 - (43%) Gaps:20/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNV--PYHSVYINLTEKPEWLVE-VSPLLKVPA 72
            |.:||...||..|||....||:||||.:..|.|.:  ....|.|:|..:|.|..| |....||||
plant    70 SSEPVQVFDGSTRLYISYTCPFAQRAWIARNYKGLQNKIELVPIDLKNRPAWYKEKVYSANKVPA 134

  Fly    73 LQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAF---INILVQ 134
            |    |.....|.|||.:.:|:|..: |.|.|..|.|::   :::.:...|.|.:|   :...:.
plant   135 L----EHNNRVLGESLDLIKYIDTNF-EGPSLTPDGLEK---QVVADELLSYTDSFSKAVRSTLN 191

  Fly   135 GTGLEDYWTALDIFEEELTK-RGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFN-ESRF 197
            ||.......|.|..|:.|:| ...|:|.| :...||....|:.||..:|   |....|.: .|..
plant   192 GTDTNAADVAFDYIEQALSKFNEGPFFLG-QFSLVDVAYAPFIERFRLI---LSDVMNVDITSGR 252

  Fly   198 PKITKWIALLKADSVVQSFYATPEQHNEFWRTRKAGNA 235
            |.:..||..:............|::..|.::.|....|
plant   253 PNLALWIQEMNKIEAYTETRQDPQELVERYKRRVQAEA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 34/86 (40%)
GstA 22..209 CDD:223698 60/194 (31%)
GST_C_Omega 109..230 CDD:198293 28/125 (22%)
GSTL2NP_191064.1 GstA 83..267 CDD:223698 59/195 (30%)
GST_N_3 83..160 CDD:290153 30/81 (37%)
GST_C_Lambda 167..283 CDD:198312 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.