DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU8

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_187538.1 Gene:GSTU8 / 820083 AraportID:AT3G09270 Length:224 Species:Arabidopsis thaliana


Alignment Length:240 Identity:61/240 - (25%)
Similarity:99/240 - (41%) Gaps:82/240 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPY----HSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGE 81
            ::|..:...|:::|..:||..|.:||    ..||.|   :...|::.:|: .|||.|   ...|.
plant     7 VKLLGLWGSPFSKRVEMVLKLKGIPYEYIEEDVYGN---RSPMLLKYNPIHKKVPVL---IHNGR 65

  Fly    82 PSLIESLIIAEYLDDKY-PENPLLPKDPLKRA---------QDKILL-----------ERFSSIT 125
             |:.|||:|.||::|.: ..:.:||:||.:||         .:|::|           ||...:.
plant    66 -SIAESLVIVEYIEDTWKTTHTILPQDPYERAMARFWAKYVDEKVMLAVKKACWGPESEREKEVK 129

  Fly   126 SAFINILVQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDY---MIWPW---FERLSVIEL 184
            .|:              ..|...|:||..:  .:|||...||||.   .|..|   |:..|.:.:
plant   130 EAY--------------EGLKCLEKELGDK--LFFGGETIGFVDIAADFIGYWLGIFQEASGVTI 178

  Fly   185 KLQKEYNFNESRFPKITKW--------------------IALLKA 209
            ...:|       |||:.:|                    :|:|||
plant   179 MTAEE-------FPKLQRWSEDFVGNNFIKEVLPPKEKLVAVLKA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 25/77 (32%)
GstA 22..209 CDD:223698 59/238 (25%)
GST_C_Omega 109..230 CDD:198293 31/147 (21%)
GSTU8NP_187538.1 GST_N_Tau 7..81 CDD:239356 26/80 (33%)
GST_C_Tau 92..217 CDD:198294 32/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.