DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_180510.1 Gene:GSTU1 / 817498 AraportID:AT2G29490 Length:224 Species:Arabidopsis thaliana


Alignment Length:219 Identity:62/219 - (28%)
Similarity:102/219 - (46%) Gaps:37/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLIESLIIAEYL 94
            |:::|..:.|..|.|||..:..:|..|...|:|::|| .|||.|    ...:..|:||.:|.||:
plant    17 PFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVL----VHNDKILLESHLILEYI 77

  Fly    95 DDKYPENPLLPKDPLKRA---------QDKILLERFSSITSAFINILVQG--TGLEDYWTALDIF 148
            |..:..:|:||:||.::|         .|:||...|.|:..|     .:|  ..:|:....|...
plant    78 DQTWKNSPILPQDPYEKAMARFWAKFIDDQILTLGFRSLVKA-----EKGREVAIEETRELLMFL 137

  Fly   149 EEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYN------FNESRFPKITKWIALL 207
            |:|:|  |..:|||...||:|.:..      |:|...|.:.:.      ..|.:||::.:||..|
plant   138 EKEVT--GKDFFGGKTIGFLDMIAG------SMIPFCLARLWKGIGIDMIPEEKFPELNRWIKNL 194

  Fly   208 KADSVVQSFYATPEQHNEFWRTRK 231
            :....|:.  ..|.:..:..|..|
plant   195 EEVEAVRG--CIPPREKQIERMTK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 23/64 (36%)
GstA 22..209 CDD:223698 58/195 (30%)
GST_C_Omega 109..230 CDD:198293 32/137 (23%)
GSTU1NP_180510.1 GST_N_Tau 8..81 CDD:239356 24/67 (36%)
GstA 9..201 CDD:223698 58/200 (29%)
GST_C_Tau 91..217 CDD:198294 34/141 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.