DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU3

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_180508.1 Gene:GSTU3 / 817496 AraportID:AT2G29470 Length:225 Species:Arabidopsis thaliana


Alignment Length:233 Identity:64/233 - (27%)
Similarity:105/233 - (45%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLL--------KVPALQ 74
            ::|| :|......|:::|..:.|..|.|||.  |::    .::||..||||        |||.| 
plant     5 EEGV-KLIGSWASPFSRRVEMALKLKGVPYD--YLD----EDYLVVKSPLLLQLNPVYKKVPVL- 61

  Fly    75 LVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERF------SSITSAFINILV 133
              ...|: .|.||.:|.||:|..:..||:||:.|..:|     :.||      ..:|...:..||
plant    62 --VHNGK-ILPESQLILEYIDQTWTNNPILPQSPYDKA-----MARFWAKFVDEQVTMIGLRSLV 118

  Fly   134 QG-----TGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYN-- 191
            :.     ..:|:....:.:.|.::|  |...|||...||:|.::.      |:|...|.:.:.  
plant   119 KSEKRIDVAIEEVQELIMLLENQIT--GKKLFGGETIGFLDMVVG------SMIPFCLARAWEGM 175

  Fly   192 ----FNESRFPKITKWIALLKADSVVQSFYATPEQHNE 225
                ..|.:||::.:||..||...:|:......|:|.|
plant   176 GIDMIPEEKFPELNRWIKNLKEIEIVRECIPDREKHIE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 28/84 (33%)
GstA 22..209 CDD:223698 57/211 (27%)
GST_C_Omega 109..230 CDD:198293 30/134 (22%)
GSTU3NP_180508.1 GST_N_Tau 8..82 CDD:239356 28/84 (33%)
GST_C_Tau 92..218 CDD:198294 31/135 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.