DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU5

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_180506.1 Gene:GSTU5 / 817494 AraportID:AT2G29450 Length:224 Species:Arabidopsis thaliana


Alignment Length:220 Identity:60/220 - (27%)
Similarity:112/220 - (50%) Gaps:30/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLI 85
            ::|..:...|:::|..:.|..|.:||..|...|..|...|:.::|: .|||.|   ...|: :::
plant     7 VKLLGIWASPFSRRVEMALKLKGIPYEYVEEILENKSPLLLALNPIHKKVPVL---VHNGK-TIL 67

  Fly    86 ESLIIAEYLDDKYPENPLLPKDPLKRAQ----DKILLERFSSITSAFINIL---VQGTGL--EDY 141
            ||.:|.||:|:.:|:||:||:||.:|::    .|::.|:..::  .||::.   .:|..:  |..
plant    68 ESHVILEYIDETWPQNPILPQDPYERSKARFFAKLVDEQIMNV--GFISMARADEKGREVLAEQV 130

  Fly   142 WTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYN------FNESRFPKI 200
            ...:...|:||.  |..||||...||:|::..      |:|...|::.:.      ..|.:||:.
plant   131 RELIMYLEKELV--GKDYFGGKTVGFLDFVAG------SLIPFCLERGWEGIGLEVITEEKFPEF 187

  Fly   201 TKWIALLKADSVVQSFYATPEQHNE 225
            .:|:..|:...:|:......|:|.|
plant   188 KRWVRNLEKVEIVKDCVPPREEHVE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 22/73 (30%)
GstA 22..209 CDD:223698 56/202 (28%)
GST_C_Omega 109..230 CDD:198293 30/132 (23%)
GSTU5NP_180506.1 GST_N_Tau 7..80 CDD:239356 23/76 (30%)
GstA 8..195 CDD:223698 55/200 (28%)
GST_C_Tau 90..217 CDD:198294 31/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.