DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTU6

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_180505.1 Gene:GSTU6 / 817493 AraportID:AT2G29440 Length:223 Species:Arabidopsis thaliana


Alignment Length:222 Identity:63/222 - (28%)
Similarity:109/222 - (49%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL-LKVPALQLVAEKGEPSLI 85
            ::|..:...|:::|..:.|..|.|||..:..:|..|...|:.:||: .|:|.|   ...|: ::|
plant     7 VKLLGIWASPFSRRIEMALKLKGVPYEYLEEDLENKSSLLLALSPIHKKIPVL---VHNGK-TII 67

  Fly    86 ESLIIAEYLDDKYPENPLLPKDPLKRAQ---------DKILLERFSSI--TSAFINILVQGTGLE 139
            ||.:|.||:|:.:..||:||:||.:|::         :||:...|:|:  |.....:|::.|.  
plant    68 ESHVILEYIDETWKHNPILPQDPFQRSKARVLAKLVDEKIVNVGFASLAKTEKGREVLIEQTR-- 130

  Fly   140 DYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYN------FNESRFP 198
               ..:...|:||.  |..||||...||:|::..      |:|...|::.:.      ..|.:||
plant   131 ---ELIMCLEKELA--GKDYFGGKTVGFLDFVAG------SMIPFCLERAWEGMGVEMITEKKFP 184

  Fly   199 KITKWIALLKADSVVQSFYATPEQHNE 225
            :..||:..||...:|.......|:|.|
plant   185 EYNKWVKKLKEVEIVVDCIPLREKHIE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 23/73 (32%)
GstA 22..209 CDD:223698 58/204 (28%)
GST_C_Omega 109..230 CDD:198293 33/134 (25%)
GSTU6NP_180505.1 GST_N_Tau 7..80 CDD:239356 24/76 (32%)
GST_C_Tau 90..214 CDD:198294 34/135 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.