DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and Gstt4

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_083748.3 Gene:Gstt4 / 75886 MGIID:1923136 Length:240 Species:Mus musculus


Alignment Length:216 Identity:50/216 - (23%)
Similarity:85/216 - (39%) Gaps:54/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RAHLVLNAKN-VPYHSVYINLTE----KPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYL 94
            ||..:...|| :|:...:::|.:    ..|: :|::||.|:|:|    :.|:..|.||:.|..||
Mouse    15 RAVYIFARKNGIPFDFQFVDLLKGHHHSKEY-IEINPLRKLPSL----KDGKFILSESVAILFYL 74

  Fly    95 DDKY--PENPLLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTALDI----FEEELT 153
            ..||  |.:...|...::...|:.:..:.::|......||         |..|.|    .||..|
Mouse    75 CRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKIL---------WIKLIIPMITGEEVPT 130

  Fly   154 KRGTPYFGGNKPGFVDYMIWPWFER-LSVIELKLQK-EYNFNESRFPKITKWIALLKADSVVQSF 216
            :|                    .|: |..::..||: |..|.:.:.......|:|....::|:..
Mouse   131 ER--------------------LEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLADLVALVEMM 175

  Fly   217 YATPEQHNEF-------WRTR 230
            ......||.|       ||.|
Mouse   176 QPMGSNHNVFVSSKLAEWRMR 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 19/64 (30%)
GstA 22..209 CDD:223698 43/186 (23%)
GST_C_Omega 109..230 CDD:198293 25/133 (19%)
Gstt4NP_083748.3 GstA 3..>170 CDD:223698 43/188 (23%)
GST_N_Theta 3..78 CDD:239348 20/67 (30%)