DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and Gstt4

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:220 Identity:54/220 - (24%)
Similarity:84/220 - (38%) Gaps:62/220 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RAHLVLNAKN-VPYHSVYINLTE----KPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYL 94
            ||..:...|| :|:...:::|.:    ..|: :|::||.|||:|:    .|:..|.||:.|..||
  Rat    15 RAVYIFARKNGIPFDFQFVDLLKGHHHSKEY-IEINPLRKVPSLR----DGKFILSESVAILCYL 74

  Fly    95 DDKY--PENPLLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTALDIFEEELTKRGT 157
            ..||  |.:...|...::...|:.:..:.::|......||         |..|.|          
  Rat    75 CRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKIL---------WIKLII---------- 120

  Fly   158 PYFGGNK-PGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPK--------IT-KWIALLKADSV 212
            |...|.: |          .|||.    |...|.|.|..:|.:        || ..|:|....::
  Rat   121 PMITGEEVP----------TERLD----KTLDEVNKNIKQFEEKFLQDKLFITGDHISLADLVAL 171

  Fly   213 VQSFYATPEQHNEF-------WRTR 230
            |:........||.|       ||.|
  Rat   172 VEMMQPMGTNHNVFISSKLAEWRMR 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 20/64 (31%)
GstA 22..209 CDD:223698 47/190 (25%)
GST_C_Omega 109..230 CDD:198293 28/137 (20%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 21/67 (31%)