DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstD10

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:188 Identity:39/188 - (20%)
Similarity:73/188 - (38%) Gaps:41/188 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKY-PENPLLPKDPLKRAQDKILLER- 120
            ||:| :::|...:|.|.   :.|. :|.||..|..||.:|| .::.|.|||..|:|   ::.:| 
  Fly    42 PEYL-KINPQHTIPTLH---DHGF-ALWESRAIMVYLVEKYGKDDKLFPKDVQKQA---LINQRL 98

  Fly   121 -------FSSITSAFI-NILVQGTGLEDYWTALDIFEEELTK--RGTPYFGGNKPGFVDYMIWPW 175
                   :.|.:..:. .|.::....|:.:..:::..|.|..  .|..|..|......|.   .:
  Fly    99 YFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADI---AF 160

  Fly   176 FERLSVIELKLQKEYNFNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTRKAG 233
            ...:|..::.     .|:..|:..:.:|             |...::....|....||
  Fly   161 LATVSTFDVA-----GFDFKRYANVARW-------------YENAKKLTPGWEENWAG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 12/36 (33%)
GstA 22..209 CDD:223698 35/162 (22%)
GST_C_Omega 109..230 CDD:198293 18/131 (14%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 13/37 (35%)
PLN02473 3..196 CDD:166114 37/182 (20%)
GST_C_Delta_Epsilon 89..205 CDD:198287 20/136 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.