DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and gstr

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:234 Identity:55/234 - (23%)
Similarity:90/234 - (38%) Gaps:48/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PYAQRAHLVLNAKNVP-YHSVYINLTEKPEWLVEVSPLLKVPALQLVAEK-GEPSLIESLIIAEY 93
            |...|..:.|..|.:. |....::..:|.....||..|  .|..||...| ||..:.||.....|
Zfish    14 PPCWRLMIALEEKQLQGYKHKLLSFDKKEHQSPEVKAL--NPRAQLPTFKHGEIVVNESFAACLY 76

  Fly    94 LDD--KYPENPLLPKDPLKRA-------QDKILLERFSSITSAFINILV-QGTGLED-------- 140
            |:.  |.....|:|.:|.:.|       :.:.|.::...:  ||.:.|| :|..||.        
Zfish    77 LESVFKSQGTRLIPDNPAEMALVYQRMFETENLQQKMYEV--AFYDWLVPEGERLESALKRNKEK 139

  Fly   141 YWTALDIFEEELTKRGT-PYFGGNKPGFVDYMIWP---WFERLSVIELKLQKEYNFNESRFPKIT 201
            ....|.::|..|.|.|. .|..|......|.:.:|   :|.|     |:..||      |.|::.
Zfish   140 LIEELKLWEGYLEKMGKGSYLAGKNFSMADVVCFPVIAYFPR-----LQCPKE------RCPRLM 193

  Fly   202 KWIALLKADSVVQSFYATPEQHNEFWRTRKAGNANYDLL 240
            ::..::|....:::.: .||     |..:..|.   |:|
Zfish   194 EYYEMVKDRPSIKASW-PPE-----WLEKPVGE---DIL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 18/65 (28%)
GstA 22..209 CDD:223698 48/201 (24%)
GST_C_Omega 109..230 CDD:198293 29/140 (21%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 49/207 (24%)
GST_N_family 5..78 CDD:238319 18/65 (28%)
GST_C_family 99..199 CDD:198286 24/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.