DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and Gstt3

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:130 Identity:35/130 - (26%)
Similarity:58/130 - (44%) Gaps:20/130 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PKPV-------LPDDGV--LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEW---LVEV 64
            |:|:       ||....  |.||........:..::......:|:....|.|.:...:   ..:|
  Rat    41 PRPISEVCQRLLPTASAMGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQV 105

  Fly    65 SPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKY--PENPLLPKDPLKRAQ-DKILLERFSSITS 126
            :||.|||||    :.|:..|.||:.|..||..||  |:: ..|:|...||: |:.|..:.:::.|
  Rat   106 NPLRKVPAL----KDGDFVLAESVAILLYLSRKYKAPDH-WYPQDLQTRARVDEYLAWQHTALRS 165

  Fly   127  126
              Rat   166  165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 24/94 (26%)
GstA 22..209 CDD:223698 31/111 (28%)
GST_C_Omega 109..230 CDD:198293 5/19 (26%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 21/78 (27%)
GST_C_Theta 149..273 CDD:198292 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.