DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstD8

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:164 Identity:39/164 - (23%)
Similarity:67/164 - (40%) Gaps:38/164 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKY-PENPLLPKDPLKRAQDKILLER 120
            |||: |:::|...:|.|   .:.|. |:.||..|..||.:|| .::.|.|.||.|:|   ::.:|
  Fly    40 KPEF-VKLNPQHCIPTL---VDDGF-SIWESRAILIYLVEKYGADDSLYPSDPQKKA---VVNQR 96

  Fly   121 --------FSSITSAFI-----NILVQGTGLEDYWTA---LDIFEEELTKRGTPYFGGNKPGFVD 169
                    |.|...|..     |.......::...:|   ||.|.|:     ..|..|:.....|
  Fly    97 LYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKVDSAFGHLDTFLED-----QEYVAGDCLTIAD 156

  Fly   170 YMIWPWFERLSVIELKLQKEYNFNESRFPKITKW 203
            ..:........|::        |:.:::|.:.:|
  Fly   157 IALLASVSTFEVVD--------FDIAQYPNVARW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 13/37 (35%)
GstA 22..209 CDD:223698 39/164 (24%)
GST_C_Omega 109..230 CDD:198293 19/111 (17%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 39/164 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 14/38 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 19/111 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.