DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstD4

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:190 Identity:52/190 - (27%)
Similarity:81/190 - (42%) Gaps:38/190 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LVLNAKNVPYHSVYINLTE----KPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKY 98
            :|..|..:..:...:.:||    |||:| :::|...:|.|   .:.|. ::.||..||.||.:||
  Fly    17 MVAKALGLELNKKQLRITEGEHLKPEFL-KLNPQHTIPTL---VDNGF-AIWESRAIAVYLVEKY 76

  Fly    99 -PENPLLPKDPLKRA--QDKI------LLERFSSITSAFINILVQGTGLEDY------WTALDIF 148
             .::.|.|.||.|||  ..::      |.:.|......||.....|.. |:|      :..||||
  Fly    77 GKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNA-ENYKKVEAAFEFLDIF 140

  Fly   149 EEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKITKWIALLK 208
            .|     |..|..|::....|..|........|:|        |:.|::|.:.:|.|..|
  Fly   141 LE-----GQDYVAGSQLTVADIAILSSVSTFEVVE--------FDISKYPNVARWYANAK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 17/60 (28%)
GstA 22..209 CDD:223698 52/190 (27%)
GST_C_Omega 109..230 CDD:198293 28/114 (25%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 50/185 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/61 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.