DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and gsto2

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001005086.1 Gene:gsto2 / 448662 XenbaseID:XB-GENE-967227 Length:241 Species:Xenopus tropicalis


Alignment Length:228 Identity:94/228 - (41%)
Similarity:127/228 - (55%) Gaps:20/228 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL 67
            |.|.||||||.|....:..:|:||||||||||||.|||.||.:.:..:.|||..||:|.:|.||.
 Frog     4 SEKSLAKGSPAPGPVSEETIRVYSMRFCPYAQRARLVLAAKGIKHEVININLKNKPDWFIEKSPF 68

  Fly    68 LKVPALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINIL 132
            ..||:|:  ...|: .:.||.|:.:|||:.||...|.|.||.::||.|:::|.||.|::.|..||
 Frog    69 GLVPSLE--TSSGQ-VIYESPIVCDYLDEVYPGKKLTPVDPFQKAQQKMIVEHFSKISTLFYKIL 130

  Fly   133 VQGTGLED-------YWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELK--LQK 188
            :.....||       ....|...:|.|.|:...:|||:....||||||||||||.:.:.|  |.|
 Frog   131 LAKKNNEDVSGVKAEVQEKLVKLDEILAKQNGLFFGGSDVSMVDYMIWPWFERLIIFDSKDCLNK 195

  Fly   189 EYNFNESRFPKITKWIALLKADSVVQSFYATPE 221
            .        |.|.||...:..|..|::.|..|:
 Frog   196 T--------PHIDKWYQQMLQDPAVKATYIEPD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 44/91 (48%)
GstA 22..209 CDD:223698 81/195 (42%)
GST_C_Omega 109..230 CDD:198293 42/122 (34%)
gsto2NP_001005086.1 GST_N_Omega 4..93 CDD:239353 44/91 (48%)
GST_C_Omega 107..229 CDD:198293 42/122 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8115
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4074
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm9331
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.