DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and gsto1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:246 Identity:105/246 - (42%)
Similarity:144/246 - (58%) Gaps:20/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSGKHLAKGSPKP-VLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVS 65
            :|.|.|.||||.| .:|.|.: |||||||||:|||..||||||.:.|.::.|||..||:|.:|.:
Zfish     3 ASQKCLGKGSPAPGPVPKDHI-RLYSMRFCPFAQRTRLVLNAKGIKYDTININLKNKPDWFLEKN 66

  Fly    66 PLLKVPALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFIN 130
            ||..||.|:  .:.|: .:.||.|..||||:.|||..|||.||.:|||.::|||.||.:|..|..
Zfish    67 PLGLVPVLE--TQSGQ-VIYESPITCEYLDEVYPEKKLLPFDPFERAQQRMLLELFSKVTPYFYK 128

  Fly   131 ILVQGTGLEDYWTALDI--------FEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQ 187
            |.|..|..||. :||:.        |.|.|.|:.:.:|||:....:|||:|||||||..:.||..
Zfish   129 IPVNRTKGEDV-SALETELKDKLSQFNEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHC 192

  Fly   188 KEYNFNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTRKAGNANYD 238
            .:..      |::.||...:..|..|::...:.|.:..|:::...||.|||
Zfish   193 LDGT------PELKKWTERMMEDPTVKATMFSTETYMVFYKSYMEGNPNYD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 47/92 (51%)
GstA 22..209 CDD:223698 86/194 (44%)
GST_C_Omega 109..230 CDD:198293 43/128 (34%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 47/92 (51%)
GstA 25..210 CDD:223698 85/194 (44%)
GST_C_Omega 107..229 CDD:198293 43/128 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7573
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37971
Inparanoid 1 1.050 180 1.000 Inparanoid score I3986
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm6382
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.