DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstZ2

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:208 Identity:54/208 - (25%)
Similarity:89/208 - (42%) Gaps:36/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEK------PEWLVEVSPLLKVPALQLVAEKGEP 82
            |||......:.|..:.:|.|.:||....|:|.:.      .|:. ||:|:.:|||||:...    
  Fly    18 LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYR-EVNPMEQVPALQIDGH---- 77

  Fly    83 SLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINILV---QGTGLEDYWT- 143
            :||||:.|..||::..|:.||||:|..|||:.:.::|...|......|::|   .|...:..|. 
  Fly    78 TLIESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQ 142

  Fly   144 -----ALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRF-PKITK 202
                 .....|:.|:.....|..|::....|..:.|..               ||..|| ..:..
  Fly   143 HWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQV---------------FNARRFHVDLRP 192

  Fly   203 WIALLKADSVVQS 215
            :..:|:.|..::|
  Fly   193 YPIILRIDRELES 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 25/76 (33%)
GstA 22..209 CDD:223698 52/200 (26%)
GST_C_Omega 109..230 CDD:198293 22/117 (19%)
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 25/76 (33%)
maiA 17..221 CDD:273527 54/208 (26%)
GST_C_Zeta 104..217 CDD:198300 22/117 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.