DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstZ1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:220 Identity:50/220 - (22%)
Similarity:90/220 - (40%) Gaps:52/220 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLV------- 62
            :|||   .||:        |||......:.|..:.|..|.:.|..       ||..|:       
  Fly    28 RHLA---TKPI--------LYSYWPSSCSWRVRVALAIKKIDYDI-------KPTSLLKTVSGHA 74

  Fly    63 ------EVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERF 121
                  ||:|:.|||:|::...    :|.:|:.|..||::..|:..|||:||:|||:.:.::|..
  Fly    75 YTDEYREVNPMQKVPSLKIDGH----TLCDSVAIIHYLEETRPQPALLPQDPVKRAKIREIVELI 135

  Fly   122 SSITSAFINILV-------QGTGLEDYWTALDI--FEEELTKRGTPYFGGNKPGFVDYMIWPWFE 177
            .|......|:.|       |......:|.:...  .|:.|:.....:..|::....|..:.|   
  Fly   136 CSGIQPLQNVSVLDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVP--- 197

  Fly   178 RLSVIELKLQKEYNFNESRFPKITK 202
                 :::..:.|..:.:.:|.|.:
  Fly   198 -----QVRNARRYKADLTPYPTIVR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 26/102 (25%)
GstA 22..209 CDD:223698 45/203 (22%)
GST_C_Omega 109..230 CDD:198293 17/103 (17%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 22/93 (24%)
maiA 35..240 CDD:273527 45/210 (21%)
GST_C_Zeta 122..236 CDD:198300 18/104 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.