DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstO1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:244 Identity:124/244 - (50%)
Similarity:172/244 - (70%) Gaps:4/244 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVS 65
            ||:.:||..||||||.||||:|:||||||||||.|.||||:||.:|||::||||.:||||...||
  Fly     1 MSNTQHLTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVS 65

  Fly    66 PLLKVPALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFIN 130
            ...|||||:||.|:|.|.|||||||.:|||:||||.||.|||.||:||:|||:|||....:||..
  Fly    66 SSTKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYY 130

  Fly   131 ILVQGTGLE----DYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYN 191
            :|:.....:    |::..|.::||||.:|.|.:|||:.||.:|||:|||.||...::...::::.
  Fly   131 LLLHDNPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFE 195

  Fly   192 FNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTRKAGNANYDLL 240
            .:..|||.:.||..|:..|..|:.||...:.|.::..:|::|.|:|::|
  Fly   196 LSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSGQADYNML 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 61/91 (67%)
GstA 22..209 CDD:223698 100/190 (53%)
GST_C_Omega 109..230 CDD:198293 45/124 (36%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 61/91 (67%)
GstA 22..216 CDD:223698 101/193 (52%)
GST_C_Omega 109..234 CDD:198293 45/124 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449071
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 1 0.900 - - E1_KOG0406
Homologene 1 1.000 - - H37971
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm6382
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - P PTHR43968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X130
1413.760

Return to query results.
Submit another query.