DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstE8

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:200 Identity:55/200 - (27%)
Similarity:84/200 - (42%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEK----PEWLVEVSPLLKVPALQLVAEKGEP 82
            |.||.....|..:.|.|.|.|..:||..|.||...|    ||:| ..:|...||.|:   :.|. 
  Fly     4 LILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFL-RKNPQHTVPTLE---DDGH- 63

  Fly    83 SLIESLIIAEYLDDKYPE-NPLLPKDPLKRAQDKILLERFSSITSAFINIL------VQGTG--- 137
            .:.:|..|:.||..||.: :.|.|||.|:||.....|...|.:  .|:|.|      :..||   
  Fly    64 FIWDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGV--VFVNGLRGITKPLFATGQTT 126

  Fly   138 --LEDYWTALDIFE-EELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPK 199
              .|.|...::|:: .|....|..:..|::....|:.:......|:|..:       .:..::..
  Fly   127 IPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVV-------IDTVKYAN 184

  Fly   200 ITKWI 204
            ||.||
  Fly   185 ITAWI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 25/76 (33%)
GstA 22..209 CDD:223698 54/199 (27%)
GST_C_Omega 109..230 CDD:198293 22/107 (21%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 54/199 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/77 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.