Sequence 1: | NP_648234.1 | Gene: | GstO3 / 38972 | FlyBaseID: | FBgn0035904 | Length: | 241 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286571.1 | Gene: | GstE8 / 37113 | FlyBaseID: | FBgn0063492 | Length: | 222 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 55/200 - (27%) |
---|---|---|---|
Similarity: | 84/200 - (42%) | Gaps: | 31/200 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEK----PEWLVEVSPLLKVPALQLVAEKGEP 82
Fly 83 SLIESLIIAEYLDDKYPE-NPLLPKDPLKRAQDKILLERFSSITSAFINIL------VQGTG--- 137
Fly 138 --LEDYWTALDIFE-EELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPK 199
Fly 200 ITKWI 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstO3 | NP_648234.1 | Thioredoxin_like | 3..95 | CDD:294274 | 25/76 (33%) |
GstA | 22..209 | CDD:223698 | 54/199 (27%) | ||
GST_C_Omega | 109..230 | CDD:198293 | 22/107 (21%) | ||
GstE8 | NP_001286571.1 | GstA | 4..196 | CDD:223698 | 54/199 (27%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 26/77 (34%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 22/107 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45460173 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |