Sequence 1: | NP_648234.1 | Gene: | GstO3 / 38972 | FlyBaseID: | FBgn0035904 | Length: | 241 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611328.1 | Gene: | GstE6 / 37111 | FlyBaseID: | FBgn0063494 | Length: | 222 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 57/205 - (27%) |
---|---|---|---|
Similarity: | 93/205 - (45%) | Gaps: | 33/205 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEK----PEWLVEVSPLLKVPALQLVAEKGEP 82
Fly 83 SLIESLIIAEYLDDKYPE-NPLLPKDPLKRAQDKILLERF---------SSITSAFINILVQG-- 135
Fly 136 -TGLEDYWTALDIFE-EELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFP 198
Fly 199 KITKWIALLK 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstO3 | NP_648234.1 | Thioredoxin_like | 3..95 | CDD:294274 | 22/76 (29%) |
GstA | 22..209 | CDD:223698 | 57/205 (28%) | ||
GST_C_Omega | 109..230 | CDD:198293 | 27/113 (24%) | ||
GstE6 | NP_611328.1 | GstA | 4..196 | CDD:223698 | 57/205 (28%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 23/77 (30%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 27/113 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45460182 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R16830 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.870 |